From 1110808a9d39d4b808aef724c861a2e1a38d2a69 Mon Sep 17 00:00:00 2001 From: Devtools Arcadia <arcadia-devtools@yandex-team.ru> Date: Mon, 7 Feb 2022 18:08:42 +0300 Subject: intermediate changes ref:cde9a383711a11544ce7e107a78147fb96cc4029 --- library/cpp/lcs/README.md | 33 +++++++ library/cpp/lcs/lcs_via_lis.cpp | 1 + library/cpp/lcs/lcs_via_lis.h | 193 +++++++++++++++++++++++++++++++++++++ library/cpp/lcs/lcs_via_lis_ut.cpp | 120 +++++++++++++++++++++++ library/cpp/lcs/ut/ya.make | 15 +++ library/cpp/lcs/ya.make | 13 +++ 6 files changed, 375 insertions(+) create mode 100644 library/cpp/lcs/README.md create mode 100644 library/cpp/lcs/lcs_via_lis.cpp create mode 100644 library/cpp/lcs/lcs_via_lis.h create mode 100644 library/cpp/lcs/lcs_via_lis_ut.cpp create mode 100644 library/cpp/lcs/ut/ya.make create mode 100644 library/cpp/lcs/ya.make (limited to 'library/cpp/lcs') diff --git a/library/cpp/lcs/README.md b/library/cpp/lcs/README.md new file mode 100644 index 0000000000..7ed3d946d6 --- /dev/null +++ b/library/cpp/lcs/README.md @@ -0,0 +1,33 @@ +A set of algorithms for approximate string matching. +==================================================== + +**Lcs_via_lis.h** +Combinatorial algorithm LCS (Longest common subsequence) through LIS (Longest increasing subsequence) for rows S1 and S2 of lengths n and m respectively (we assume that n < m). + +Complexity is O(r log n) by time and O(r) of additional memory, where r is the number of pairs (i, j) for which S1[i] = S2[j]. Thus for the uniform distribution of letters of an alphabet of s elements the estimate is O(nm / s * log n). + +Effective for large alphabets s = O(n) (like hashes of words in a text). If only the LCS length is needed, the LCS itself will not be built. +See Gusfield, Algorithms on Strings, Trees and Sequences, 1997, Chapt.12.5 +Or here: http://www.cs.ucf.edu/courses/cap5937/fall2004/Longest%20common%20subsequence.pdf + +#### Summary of the idea: +Let's suppose we have a sequence of numbers. + +Denote by: +- IS is a subsequence strictly increasing from left to right. +- LIS is the largest IS of the original sequence. +- DS is a subsequence that does not decrease from left to right. +- C is a covering of disjoint DS of the original sequence. +- SC is the smallest such covering. + +It is easy to prove the theorem that the dimensions of SC and LIS are the same, and it is possible to construct LIS from SC. + +Next, let's suppose we have 2 strings of S1 and S2. It can be shown that if for each symbol in S1 we take the list of its appearances in S2 in the reverse order, and concatenate all such lists keeping order, then any IS in the resulting list will be equivalent to some common subsequence S1 and S2 of the same length. And, consequently, LIS will be equivalent to LCS. + +The idea of the algorithm for constructing DS: +- Going along the original sequence, for the current member x in the list of its DS we find the leftmost, such that its last term is not less than x. +- If there is one, then add x to the end. +- If not, add a new DS consisting of x to the DS list. + +It can be shown that the DS list constructed this way will be SC. + diff --git a/library/cpp/lcs/lcs_via_lis.cpp b/library/cpp/lcs/lcs_via_lis.cpp new file mode 100644 index 0000000000..1a52608aed --- /dev/null +++ b/library/cpp/lcs/lcs_via_lis.cpp @@ -0,0 +1 @@ +#include "lcs_via_lis.h" diff --git a/library/cpp/lcs/lcs_via_lis.h b/library/cpp/lcs/lcs_via_lis.h new file mode 100644 index 0000000000..d26733d94e --- /dev/null +++ b/library/cpp/lcs/lcs_via_lis.h @@ -0,0 +1,193 @@ +#pragma once + +#include <library/cpp/containers/paged_vector/paged_vector.h> + +#include <util/generic/ptr.h> +#include <util/generic/hash.h> +#include <util/generic/vector.h> +#include <util/generic/algorithm.h> +#include <util/memory/pool.h> + +namespace NLCS { + template <typename TVal> + struct TLCSCtx { + typedef TVector<ui32> TSubsequence; + typedef THashMap<TVal, TSubsequence, THash<TVal>, TEqualTo<TVal>, ::TPoolAllocator> TEncounterIndex; + typedef TVector<std::pair<ui32, ui32>> TLastIndex; + typedef NPagedVector::TPagedVector<TSubsequence, 4096> TCover; + + TMemoryPool Pool; + THolder<TEncounterIndex> Encounters; + TLastIndex LastIndex; + TCover Cover; + + TSubsequence ResultBuffer; + + TLCSCtx() + : Pool(16 * 1024 - 64, TMemoryPool::TExpGrow::Instance()) + { + Reset(); + } + + void Reset() { + Encounters.Reset(nullptr); + Pool.Clear(); + Encounters.Reset(new TEncounterIndex(&Pool)); + LastIndex.clear(); + Cover.clear(); + ResultBuffer.clear(); + } + }; + + namespace NPrivate { + template <typename TIt, typename TVl> + struct TSequence { + typedef TIt TIter; + typedef TVl TVal; + + const TIter Begin; + const TIter End; + const size_t Size; + + TSequence(TIter beg, TIter end) + : Begin(beg) + , End(end) + , Size(end - beg) + { + } + }; + + template <typename TVal, typename TSequence, typename TResult> + size_t MakeLCS(TSequence s1, TSequence s2, TResult* res = nullptr, TLCSCtx<TVal>* ctx = nullptr) { + typedef TLCSCtx<TVal> TCtx; + + THolder<TCtx> ctxhld; + + if (!ctx) { + ctxhld.Reset(new TCtx()); + ctx = ctxhld.Get(); + } else { + ctx->Reset(); + } + + size_t maxsize = Max(s1.Size, s2.Size); + auto& index = *(ctx->Encounters); + + for (auto it = s1.Begin; it != s1.End; ++it) { + index[*it]; + } + + for (auto it = s2.Begin; it != s2.End; ++it) { + auto hit = index.find(*it); + + if (hit != index.end()) { + hit->second.push_back(it - s2.Begin); + } + } + + if (!res) { + auto& lastindex = ctx->ResultBuffer; + lastindex.reserve(maxsize); + + for (auto it1 = s1.Begin; it1 != s1.End; ++it1) { + const auto& sub2 = index[*it1]; + + for (auto it2 = sub2.rbegin(); it2 != sub2.rend(); ++it2) { + ui32 x = *it2; + + auto lit = LowerBound(lastindex.begin(), lastindex.end(), x); + + if (lit == lastindex.end()) { + lastindex.push_back(x); + } else { + *lit = x; + } + } + } + + return lastindex.size(); + } else { + auto& lastindex = ctx->LastIndex; + auto& cover = ctx->Cover; + + lastindex.reserve(maxsize); + + for (auto it1 = s1.Begin; it1 != s1.End; ++it1) { + const auto& sub2 = index[*it1]; + + for (auto it2 = sub2.rbegin(); it2 != sub2.rend(); ++it2) { + ui32 x = *it2; + + auto lit = LowerBound(lastindex.begin(), lastindex.end(), std::make_pair(x, (ui32)0u)); + + if (lit == lastindex.end()) { + lastindex.push_back(std::make_pair(x, cover.size())); + cover.emplace_back(); + cover.back().push_back(x); + } else { + *lit = std::make_pair(x, lit->second); + cover[lit->second].push_back(x); + } + } + } + + if (cover.empty()) { + return 0; + } + + std::reverse(cover.begin(), cover.end()); + + auto& resbuf = ctx->ResultBuffer; + + resbuf.push_back(cover.front().front()); + + for (auto it = cover.begin() + 1; it != cover.end(); ++it) { + auto pit = UpperBound(it->begin(), it->end(), resbuf.back(), std::greater<ui32>()); + + Y_VERIFY(pit != it->end(), " "); + + resbuf.push_back(*pit); + } + + std::reverse(resbuf.begin(), resbuf.end()); + + for (auto it = resbuf.begin(); it != resbuf.end(); ++it) { + res->push_back(*(s2.Begin + *it)); + } + + return lastindex.size(); + } + } + } + + template <typename TVal, typename TIter, typename TResult> + size_t MakeLCS(TIter beg1, TIter end1, TIter beg2, TIter end2, TResult* res = nullptr, TLCSCtx<TVal>* ctx = nullptr) { + typedef NPrivate::TSequence<TIter, TVal> TSeq; + + size_t sz1 = end1 - beg1; + size_t sz2 = end2 - beg2; + + if (sz2 > sz1) { + DoSwap(beg1, beg2); + DoSwap(end1, end2); + DoSwap(sz1, sz2); + } + + return NPrivate::MakeLCS<TVal>(TSeq(beg1, end1), TSeq(beg2, end2), res, ctx); + } + + template <typename TVal, typename TColl, typename TRes> + size_t MakeLCS(const TColl& coll1, const TColl& coll2, TRes* res = nullptr, TLCSCtx<TVal>* ctx = nullptr) { + return MakeLCS<TVal>(coll1.begin(), coll1.end(), coll2.begin(), coll2.end(), res, ctx); + } + + template <typename TVal, typename TIter> + size_t MeasureLCS(TIter beg1, TIter end1, TIter beg2, TIter end2, TLCSCtx<TVal>* ctx = nullptr) { + return MakeLCS<TVal>(beg1, end1, beg2, end2, (TVector<TVal>*)nullptr, ctx); + } + + template <typename TVal, typename TColl> + size_t MeasureLCS(const TColl& coll1, const TColl& coll2, TLCSCtx<TVal>* ctx = nullptr) { + return MeasureLCS<TVal>(coll1.begin(), coll1.end(), coll2.begin(), coll2.end(), ctx); + } +} diff --git a/library/cpp/lcs/lcs_via_lis_ut.cpp b/library/cpp/lcs/lcs_via_lis_ut.cpp new file mode 100644 index 0000000000..f6ad5152b6 --- /dev/null +++ b/library/cpp/lcs/lcs_via_lis_ut.cpp @@ -0,0 +1,120 @@ +#include <util/generic/utility.h> +#include <util/string/util.h> +#include <library/cpp/testing/unittest/registar.h> +#include "lcs_via_lis.h" + +class TLCSTest: public TTestBase { + UNIT_TEST_SUITE(TLCSTest); + UNIT_TEST(LCSTest); + UNIT_TEST_SUITE_END(); + +private: + size_t Length(TStringBuf s1, TStringBuf s2) { + TVector<TVector<size_t>> c; + c.resize(s1.size() + 1); + + for (size_t i = 0; i < c.size(); ++i) { + c[i].resize(s2.size() + 1); + } + + for (size_t i = 0; i < s1.size(); ++i) { + for (size_t j = 0; j < s2.size(); ++j) { + if (s1[i] == s2[j]) + c[i + 1][j + 1] = c[i][j] + 1; + else + c[i + 1][j + 1] = Max(c[i + 1][j], c[i][j + 1]); + } + } + + return c[s1.size()][s2.size()]; + } + + void CheckLCSLength(TStringBuf s1, TStringBuf s2, size_t size) { + size_t len = NLCS::MeasureLCS<char>(s1, s2); + + UNIT_ASSERT_VALUES_EQUAL(len, Length(s1, s2)); + UNIT_ASSERT_VALUES_EQUAL(len, size); + } + + void CheckLCSString(TStringBuf s1, TStringBuf s2, TStringBuf reflcs) { + TString lcs; + size_t len = NLCS::MakeLCS<char>(s1, s2, &lcs); + const char* comment = Sprintf("%s & %s = %s", s1.data(), s2.data(), reflcs.data()).c_str(); + + UNIT_ASSERT_VALUES_EQUAL_C(Length(s1, s2), len, comment); + UNIT_ASSERT_VALUES_EQUAL_C(lcs.size(), len, comment); + UNIT_ASSERT_VALUES_EQUAL_C(NLCS::MeasureLCS<char>(s1, s2), len, comment); + UNIT_ASSERT_VALUES_EQUAL_C(reflcs, TStringBuf(lcs), comment); + } + + void LCSTest() { + CheckLCSString("abacx", "baabca", "bac"); + const char* m = "mama_myla_ramu"; + const char* n = "papa_lubil_mamu"; + const char* s = "aa_l_amu"; + CheckLCSString(m, n, s); + CheckLCSString(n, m, s); + CheckLCSString(m, m, m); + CheckLCSString(m, "", ""); + CheckLCSString("", m, ""); + CheckLCSString("", "", ""); + { + const char* s1 = + "atmwuaoccmgirveexxtbkkmioclarskvicyesddirlrgflnietcagkswbvsdnxksipfndmusnuee" + "tojygyjyobdfiutsbruuspvibmywhokxsarwbyirsqqnxxnbtkmucmdafaogwmobuuhejspgurpe" + "ceokhgdubqewnyqtwwqfibydbcbxhofvcjsftamhvnbdwxdqnphcdiowplcmguxmnpcufrahjagv" + "cpjqsyqurrhyghkasnodqqktldyfomgabrxdxpubenfscamoodgpocilewqtbsncggwvkkpuasdl" + "cltxywovqjligwhjxnmmtgeuujphgtdjrnxcnmwwbgxnpiotgnhyrxuvxkxdlgmpfeyocaviuhec" + "ydecqmttjictnpptoblxqgcrsojrymakgdjvcnppinymdrlgdfpyuykwpmdeifqwupojsgmruyxs" + "qijwnxngaxnppxgusyfnaelccytxwrkhxxirhnsastdlyejslrivkrpovnhbwxcdmpqbnjthjtlj" + "wnoayakfnpcwdnlgnrghjhiianhsncbjehlsoldjykymduytyiygrdreicjvghdibyjsmxnwvrqb" + "jjkjfrtlonfarbwhovladadlbyeygvuxcutxjqhosuxbemtwsqjlvvyegsfgeladiovecfxfymct" + "ulofkcogguantmicfrhpnauetejktkhamfuwirjvlyfgjrobywbbitbnckiegbiwbtmapqrbbqws" + "wviuplyprwwqoekiuxsmwgwyuwgeurvxempguwmgtadvrkxykffjxfdyxmsibmdlqhldlfbiaegt" + "kswcmfidnrhaibuscoyukwhdtoqwlpwnfgamvfqjpfklgurcwvgsluyoyiuumrwwsqgxatxnxhil" + "ywpkeaugfaahmchjruavepvnygcmcjdnvulwcuhlolsfxcsrjciwajbhdahpldcfggubcxalqxrl" + "coaiyeawxyxujtynodhnxbhs"; + const char* s2 = + "yjufxfeiifhrmydpmsqqgjwtpcxbhqmfpnvsvsapqvsmqmugpqehbdsiiqhcrasxuhcvswcwanwb" + "knesbuhtbaitcwebsdbbxwyubjoroekjxweeqnqmydbdbgbnfymcermhpbikocpsfccwjemxjpmc" + "hkhtfaoqgvvtpipujsxesiglgnpsdwfjhcawkfpffuyltqqhdkeqwkfpqjhnjdsnxlevyvydikbr" + "hnicihnevsofgouxjcnjjknxwwgaaaikdcxmhxfowadqudrapvwlcuwatrmiweijljdehxiwqrnq" + "tnhgukbwmadcjpfnxtswhmwnvvnwsllkyshfobrdmukswpgwunysxpnnlmccolvqyjsvagulpcda" + "ctsnyjleqgttcgpnhlnagxenuknpxiramgeshhjyoesupkcfcvvpwyweuvcwrawsgvfshppijuug" + "hdnujdqjtcdissmlnjgibdljjxntxrgytxlbgvsrrusatqelspeoyvndjifjqxqrpduwbyojjbhi" + "tmondbbnuuhpkglmfykeheddwkxjyapfniqoic"; + CheckLCSLength(s1, s2, 247); + } + { + const char* s1 = + "ssyrtvllktbhijkyckviokukaodexiykxcvlvninoasblpuujnqnilnhmacsulaulskphkccnfop" + "jlhejqhemdpnihasouinuceugkfkaifdepvffntbkfivsddtxyslnlwiyfbbpnrwlkryetncahih" + "vqcrdvvehvrxgnitghbomkprdngrqdswypwfvpdrvqnavxnprakkgoibsxybngvenlbfcghcyldn" + "kssfuxvpvfhaawqiandxpsrkyqtiltmojmmwygevhodvsuvdojvwpvvbwpbbnerriufrwgwcjlgx" + "jcjchsfiomtkowihdtcyewknlvdeankladmdhwqxokmunttgaqdsbuyhekkxatpydfgquyxuucda" + "dllepofxoirmaablfyyibcnqkdbnsaygkqkbvupdhajfshouofnokwlbdtglrbklpgknyuiedppl" + "chxbnnmbumdtrsgwitjlmkkdxysvmsvcdulmanmsdeqkmwgfthmntdbthdthdodnubqajpfyssea" + "hwxymiyubkhhxlbmjptujiemrdljqkskdkuokvimencavihwqdaqtcljrgwvxpuegnoecobfllwu" + "upsfhjrrpiqtjlwigjkpltwfpoqxsdrojtawpaximslojqtadsactemuhpnshkgyoyouldanktcg" + "dhxdpwawabxwjhnjdmewrwtciquuiqnwdsbdvnuvjyewmjppkwvcotptmyrsqaovmaysjuvtenuy" + "orvdsssgjgcgksdwaaladocotgveuscwauawdhqlkqsjtmltvkkcfkgwpdtormkefkigkppwpvsy" + "fpblccsbyboouahotiifixsjuxlvqpqmpmkcgbvsefkqasearilhlxuqdfqqxxohhbdyiudqsree" + "btwfxdtxlaynrusgbffhltthkejitseuqyeqvhqgyobijwmspwbsisghsarji"; + const char* s2 = + "lcnygawhsrprxafwnwxnrxurpnqwwtwuciuexxvswckwopnmhhmhvdwmxtgceitqofivvavnqlmo" + "hbieyaxcysagyqcvijxyowiognsntxcdlmueoafqvqwafyhgyoewhwxvqswvwfkqohtutawwnmhr" + "pjmhyiygdekonlxhkbeaheqvnqbwhambhrrhkyfcehjfblgriumapavbcxxdqytiuylxmhtjjloa" + "fvnyhqsgalacknksxxxilgfcankxreaburvmxukmfprfpmfqgqhmirlnltkjxslumhtamtndaffh" + "ybfywiwjlafnsgsvywflsfkeeidwptigidvhnqdjiwvgkfynncyujodsjiglubptsdofftfxayno" + "txoykiivbvvipdpcgjadvbanaeljdbxxynlqqpdphirrbjqfqtnxabitncafatbosjnlimxfxlrh" + "thlfsdyfbhtwywewqubjcvskmwxwjyhesqbviflihnjfejcgjtkgicgmmcurynmdaoifojmedcqb" + "aeqalxnljvglnvyverrtosfeeuajyxkmmpjgcioqxnnqpjokxaenfoudondtahjduymwsyxpbvrf" + "kpgiavuihdliphwojgjobafhjshjnmhufciepexevtfwcybtripqmnekkirxmljumyxjpqbvmftt" + "xmfwokjskummmkaksbeoowfgjwiumpbkdujexectnghqjjuotofwuwvcgtluephymdkrscbfiaeg" + "aaypnclkstfqimisanikjxocmhcrotkntprwjbuudswuyuujfawjucwgifhqgepxeidmvcwqsqrv" + "karuvpnxhmrvdcocidgtuxasdqkwsdvijmnpmayhfiva"; + CheckLCSLength(s1, s2, 288); + } + } +}; +UNIT_TEST_SUITE_REGISTRATION(TLCSTest) diff --git a/library/cpp/lcs/ut/ya.make b/library/cpp/lcs/ut/ya.make new file mode 100644 index 0000000000..3d12898788 --- /dev/null +++ b/library/cpp/lcs/ut/ya.make @@ -0,0 +1,15 @@ +OWNER(velavokr) + +UNITTEST() + +PEERDIR( + ADDINCL library/cpp/lcs +) + +SRCDIR(library/cpp/lcs) + +SRCS( + lcs_via_lis_ut.cpp +) + +END() diff --git a/library/cpp/lcs/ya.make b/library/cpp/lcs/ya.make new file mode 100644 index 0000000000..3a7caafc88 --- /dev/null +++ b/library/cpp/lcs/ya.make @@ -0,0 +1,13 @@ +LIBRARY() + +OWNER(velavokr) + +PEERDIR( + library/cpp/containers/paged_vector +) + +SRCS( + lcs_via_lis.cpp +) + +END() -- cgit v1.2.3